PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00134814001
Common NameGSBRNA2T00134814001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 283aa    MW: 31772.3 Da    PI: 8.7857
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00134814001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.65.7e-383392261
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                          +++lkcprC+s+ntk+Cyynny+lsqPr+fCk+CrryWt+GGalrnvP+Ggg+rk kks
  GSBRNA2T00134814001 33 DQQTLKCPRCNSSNTKLCYYNNYNLSQPRHFCKSCRRYWTRGGALRNVPIGGGCRKTKKS 92
                         57899***************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.0E-323591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0593791IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-243991IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MSSHTNLHSP KPDHRISGTS HTKKSPSSSS SQDQQTLKCP RCNSSNTKLC YYNNYNLSQP  60
RHFCKSCRRY WTRGGALRNV PIGGGCRKTK KSFKPNTSTP PCQRFYSSVM EDSSKFFPPP  120
TTMGFQLMNN QEVLGLRSME QAKTTPVDVR SGLSLMGFGD YNNHSPATFT TAGTLATSIE  180
TLSCLNQDLH WRLQQQRMAM LLGNSTEENV VVERPQPVLY RNLEIVNSLP TKKGENQTEW  240
SFSYNNDNEE VINNNDTNNT GGSDQRNGVQ AWTDLNLCHD SW*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00134814001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892660.0AC189266.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB022L12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013606218.10.0PREDICTED: dof zinc finger protein DOF5.7
SwissprotQ9LSL61e-143DOF57_ARATH; Dof zinc finger protein DOF5.7
TrEMBLA0A078CWZ10.0A0A078CWZ1_BRANA; BnaC09g07030D protein
STRINGBra037822.1-P1e-171(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49502850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.11e-122Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]